LL-37
What Is LL-37? The Antimicrobial Peptide for Innate Immunity
LL-37 is the only human cathelicidin antimicrobial peptide — a 37-amino-acid peptide that represents one of the body's most important first-line defense molecules against infection. It is produced by immune cells, epithelial surfaces, and barrier tissues throughout the body, and it functions as a broad-spectrum antimicrobial agent capable of killing bacteria, viruses, and fungi. But LL-37 is far more than just a natural antibiotic. It is a multifunctional immune effector that modulates inflammation, promotes wound healing, disrupts bacterial biofilms, enhances immune cell recruitment, and influences the transition from innate to adaptive immunity.
The research interest in LL-37 has grown substantially as antibiotic resistance has become a global health crisis. Unlike traditional antibiotics, which target specific bacterial processes and can be defeated by single mutations, LL-37 physically disrupts bacterial membranes and operates through multiple simultaneous mechanisms that are much harder for bacteria to evolve resistance against. This has positioned LL-37 and its analogs as potential next-generation antimicrobial therapeutics.
This guide covers what LL-37 is, how it works across its multiple functions, what the clinical research shows, the potential therapeutic applications, and the current status of LL-37 as both a research peptide and a clinical candidate.
What Is LL-37?
LL-37 is derived from the C-terminal end of the human cathelicidin precursor protein hCAP-18 (human cationic antimicrobial protein of 18 kDa). The precursor protein is encoded by the CAMP gene and stored in neutrophil granules and epithelial cells in its inactive pro-form. When immune activation occurs — during infection, tissue damage, or inflammation — proteolytic enzymes (primarily proteinase 3 in neutrophils and kallikreins in skin) cleave hCAP-18 to release the active LL-37 peptide.
The name "LL-37" refers to its structure: the peptide begins with two leucine (L) residues and is 37 amino acids long. Its sequence is [LL-37, 37 aa], and it forms an amphipathic alpha-helical structure in membrane environments — with one side hydrophobic (membrane-inserting) and one side positively charged (attracted to negatively charged bacterial membranes).
LL-37 is expressed in multiple tissues and cell types:
- Neutrophils: The primary storage site; LL-37 is released from specific granules upon neutrophil activation
- Macrophages and monocytes: Produce LL-37 in response to infection
- Epithelial cells: Skin, airway, intestinal, and urogenital epithelia all produce LL-37
- Bone marrow: LL-37 is expressed in bone marrow cells
- Wound tissue: Expression is upregulated during wound healing
Vitamin D Connection
A critically important aspect of LL-37 biology is its regulation by vitamin D. The CAMP gene (encoding the LL-37 precursor) contains a vitamin D response element in its promoter region. When vitamin D (specifically 1,25-dihydroxyvitamin D, the active form) binds to the vitamin D receptor, it directly upregulates CAMP gene expression and LL-37 production. This is one of the most well-established mechanisms linking vitamin D to immune function and may explain some of the observed associations between vitamin D deficiency and increased infection susceptibility.
How LL-37 Works: Mechanism of Action
Direct Antimicrobial Activity
LL-37's primary antimicrobial mechanism involves physical disruption of microbial membranes:
- Electrostatic attraction: The positively charged LL-37 peptide is attracted to the negatively charged lipopolysaccharide (LPS) layer of Gram-negative bacteria or the lipoteichoic acid of Gram-positive bacteria
- Membrane insertion: LL-37 inserts its hydrophobic face into the lipid bilayer
- Pore formation or membrane disruption: Multiple LL-37 molecules aggregate in the membrane, forming pores or causing general membrane destabilization (the "carpet model" or "toroidal pore model")
- Cell death: Loss of membrane integrity leads to leakage of cellular contents and bacterial death
This mechanism is effective against:
- Gram-negative bacteria: E. coli, Pseudomonas aeruginosa, Klebsiella pneumoniae
- Gram-positive bacteria: Staphylococcus aureus (including MRSA), Streptococcus species
- Mycobacteria: Including Mycobacterium tuberculosis
- Fungi: Candida albicans and other fungal pathogens
- Viruses: Some enveloped viruses are susceptible to LL-37-mediated membrane disruption
Biofilm Disruption
One of LL-37's most clinically relevant properties is its ability to disrupt bacterial biofilms — structured communities of bacteria encased in a protective extracellular matrix that are notoriously resistant to conventional antibiotics. Biofilms are responsible for chronic wound infections, prosthetic joint infections, catheter-associated infections, and chronic sinusitis.
LL-37 disrupts biofilms through multiple mechanisms:
- Preventing initial bacterial attachment to surfaces
- Disrupting the extracellular polymeric substance (EPS) matrix
- Killing bacteria within established biofilms
- Inhibiting quorum sensing (bacterial communication) that maintains biofilm structure
Immune Cell Recruitment (Chemotaxis)
LL-37 functions as a chemoattractant, recruiting immune cells to sites of infection:
- Neutrophils: LL-37 attracts neutrophils through formyl peptide receptor-like 1 (FPRL1)
- Monocytes and macrophages: Recruited via FPRL1 and other mechanisms
- T cells: LL-37 can attract T lymphocytes to infection sites
- Mast cells: LL-37 activates mast cells, triggering degranulation and further immune mediator release
Inflammation Modulation
LL-37's relationship with inflammation is nuanced and context-dependent:
- LPS neutralization: LL-37 directly binds and neutralizes lipopolysaccharide (endotoxin), reducing the inflammatory response to Gram-negative bacterial components
- Cytokine modulation: Depending on context, LL-37 can either promote or suppress inflammatory cytokine production
- Anti-inflammatory in some contexts: LL-37 can suppress pro-inflammatory gene expression through modulation of TLR signaling
- Pro-inflammatory in others: At sites of active infection, LL-37 promotes inflammatory responses needed to clear pathogens
Wound Healing
LL-37 promotes wound healing through:
- Stimulation of keratinocyte migration and proliferation
- Promotion of angiogenesis (new blood vessel formation) at wound sites
- Enhancement of re-epithelialization
- Reduction of infection at wound sites (through direct antimicrobial activity)
Clinical Research Status
Topical Applications
The most advanced clinical applications for LL-37 involve topical formulations:
Chronic wound treatment: LL-37 has been studied in clinical trials for the treatment of chronic venous leg ulcers — wounds that are resistant to healing, often due to biofilm-mediated infection. Early clinical data has shown improved healing rates with topical LL-37 application compared to placebo.
Burn wound treatment: The antimicrobial and wound-healing properties of LL-37 make it a candidate for burn wound management, where infection is a major cause of morbidity and mortality.
Respiratory Applications
LL-37's expression in airway epithelium and its activity against respiratory pathogens have generated interest in pulmonary applications:
- Potential adjunct therapy for tuberculosis (TB)
- Possible role in chronic obstructive pulmonary disease (COPD) management
- Interest as an anti-biofilm agent for cystic fibrosis lung infections
LL-37 in Infectious Disease
Research has explored LL-37's role in several infectious disease contexts:
- Sepsis: LL-37's LPS-neutralizing properties are potentially relevant for reducing sepsis-associated inflammation
- Urinary tract infections: Endogenous LL-37 expression in urinary epithelium contributes to UTI defense
- HIV: LL-37 has demonstrated anti-HIV activity in vitro through multiple mechanisms
Limitations of Current Research
- Most efficacy data is from in vitro and animal studies
- Human clinical trial data is limited to early-phase studies
- Systemic administration raises concerns about host cell toxicity (LL-37 can damage host cell membranes at high concentrations)
- Stability and delivery challenges for clinical formulations
- Cost of synthetic LL-37 production at pharmaceutical scale
LL-37 and Disease States
Conditions Associated with LL-37 Deficiency
Low LL-37 levels have been associated with increased susceptibility to:
- Recurrent skin infections
- Chronic wounds
- Periodontitis
- Respiratory infections
- Urinary tract infections
Conditions Associated with Excess LL-37
Conversely, excessive LL-37 expression has been implicated in:
- Rosacea: Overexpression of LL-37 in skin contributes to the inflammatory component of rosacea
- Psoriasis: LL-37 can form complexes with self-DNA that trigger autoimmune inflammation via plasmacytoid dendritic cell activation
- Atherosclerosis: LL-37 may contribute to vascular inflammation
This dual nature — protective at appropriate levels, pathogenic in excess — underscores the importance of balanced LL-37 activity and the complexity of therapeutic development.
Side Effects and Safety Considerations
Known Concerns
- Host cell toxicity: At high concentrations, LL-37 can damage host cell membranes, particularly red blood cells (hemolysis). This limits the therapeutic window for systemic administration.
- Pro-inflammatory potential: In some contexts, LL-37 can trigger excessive inflammation, particularly relevant for individuals with rosacea, psoriasis, or other inflammatory skin conditions
- Injection site reactions: Subcutaneous or intramuscular injection may cause local pain, redness, and swelling
- Allergic reactions: Possible, though rare in clinical studies
What We Don't Know
- Optimal dosing for different clinical indications
- Safety of chronic systemic administration
- Interactions with immunosuppressive medications
- Safety in pregnancy and lactation
- Long-term effects of exogenous LL-37 supplementation on endogenous production
Natural Ways to Support LL-37 Production
Given that LL-37 expression is regulated by vitamin D:
- Vitamin D optimization: Maintaining adequate vitamin D levels (typically defined as 30-50 ng/mL serum 25-hydroxyvitamin D) supports endogenous LL-37 production
- Sun exposure: Moderate UV exposure increases vitamin D synthesis and subsequently LL-37 production
- Vitamin D supplementation: For individuals with documented deficiency
This vitamin D-LL-37 connection may be one of the most clinically actionable pieces of innate immunity biology — optimizing vitamin D status is a safe, inexpensive intervention that supports the body's own antimicrobial peptide production.
For related immune peptide reading, see our Thymosin Alpha 1 profile. For other peptides with wound healing properties, see our BPC-157 profile, TB-500 profile, and GHK-Cu profile. For peptide safety guidance, see our 1.
The Bottom Line
LL-37 is a fascinating multifunctional peptide that serves as a critical component of innate immunity. Its broad-spectrum antimicrobial activity, biofilm-disrupting properties, immune-modulating capabilities, and wound-healing promotion make it one of the most biologically versatile peptides known. Its potential as a next-generation antimicrobial — particularly against antibiotic-resistant organisms and biofilm-mediated infections — addresses one of the most urgent challenges in modern medicine.
The clinical development of LL-37 therapeutics is still in relatively early stages, with most human data limited to topical wound healing applications. Systemic use faces challenges related to host cell toxicity, stability, and delivery. For individuals interested in supporting their own LL-37 production, vitamin D optimization represents the most evidence-based approach.
Frequently Asked Questions
Frequently Asked Questions
Is LL-37 available as a supplement?
LL-37 is available through some research peptide vendors and compounding pharmacies, but it is not available as a conventional dietary supplement. It is not FDA-approved for any indication. The most evidence-based way to support your body's own LL-37 production is through vitamin D optimization, as the CAMP gene encoding LL-37 is directly regulated by vitamin D signaling.
Can LL-37 fight antibiotic-resistant bacteria?
Yes, in laboratory studies. LL-37 has demonstrated activity against antibiotic-resistant bacteria including MRSA (methicillin-resistant Staphylococcus aureus) and multi-drug resistant Gram-negative organisms. Its mechanism — physical membrane disruption — is fundamentally different from conventional antibiotics and much harder for bacteria to develop resistance against. However, clinical use against antibiotic-resistant infections in humans has not yet been validated in large clinical trials.
Does vitamin D increase LL-37 levels?
Yes. The CAMP gene encoding the LL-37 precursor contains a vitamin D response element in its promoter region. Active vitamin D (1,25-dihydroxyvitamin D) directly upregulates CAMP gene expression and LL-37 production. This is one of the most well-established links between vitamin D and immune function. Maintaining adequate vitamin D levels (30-50 ng/mL serum 25-hydroxyvitamin D) supports optimal LL-37 production.
Can LL-37 worsen rosacea or psoriasis?
Potentially, yes. Excessive LL-37 expression is implicated in both rosacea and psoriasis pathogenesis. In rosacea, overexpressed LL-37 is processed into pro-inflammatory fragments. In psoriasis, LL-37 complexes with self-DNA to trigger autoimmune inflammation. Individuals with these conditions should exercise caution with exogenous LL-37 supplementation and discuss with their dermatologist.
How is LL-37 administered?
In research and clinical trial settings, LL-37 has been administered topically (for wound healing applications), subcutaneously, and intramuscularly. Topical application avoids systemic toxicity concerns and is the most clinically advanced route. Subcutaneous injection is used in the research peptide community but carries considerations related to host cell toxicity at higher systemic concentrations. There is no oral formulation, as LL-37 would be degraded by gastrointestinal enzymes.
What is the difference between LL-37 and other antimicrobial peptides?
LL-37 is the only human cathelicidin, but there are thousands of antimicrobial peptides across species. LL-37 is unique among human AMPs for its length (37 amino acids), alpha-helical structure, and multifunctionality — combining direct antimicrobial activity with immunomodulatory, chemotactic, and wound-healing properties. Other human AMPs, such as defensins, have different structures and somewhat different activity profiles. LL-37's broad-spectrum activity and multi-functionality make it one of the most versatile human AMPs.
Is LL-37 the same as cathelicidin?
LL-37 is the active peptide derived from the human cathelicidin precursor protein hCAP-18. Cathelicidin refers to the broader protein family, while LL-37 is the specific active antimicrobial peptide released from the human cathelicidin precursor through enzymatic cleavage. In common usage, 'cathelicidin' and 'LL-37' are often used interchangeably when referring to the human peptide, though technically cathelicidin is the precursor and LL-37 is the processed active form.